Appraw home
Register / Login
  • Set your phone/device
  • Android

    • Android Games
    • Android Apps
    • Android Themes
    • Android Keyboards
    • Live Wallpapers
    • Android Ringtones
    • APK Downloader
  • Windows

    • Windows Apps (All)
  • Downloads

    • Free Ringtones
    • Alert Tones
    • Wallpapers
  • Apple

    • iPhone Ringtones
  1. Home
  2. Free Android Games
  3. 3 Pyramid Tripeaks
  4. Download 3 Pyramid Tripeaks APK 1.0.144

Download 3 Pyramid Tripeaks APK 1.0.144

Happy Planet Games
Rated 4.00 (8,136)
↓ 14
Download APK (Latest Version)
✔ Free & Safe APK Download for Android - 33.53MB
Old Versions (1)
You are downloading 3 Pyramid Tripeaks 1.0.144 APK file latest free Android Game (air.com.differencegames.threepyramidtripeaksfree.apk). 3 Pyramid Tripeaks is a free CardSolitaire game which is rated 3.90 out of 5 (based on 8,136 reviews). 3 Pyramid Tripeaks can be downloaded and installed on Android version 2.3 (Gingerbread) and above.
More info & screenshots
Updated
22nd March 2015
Version
1.0.144
File Type
APK
File Size
33.53 MB
Requires
Android 2.3 or above
Category
Card
Package
air.com.differencegames.threepyramidtripeaksfree
Solitaire

Download 3 Pyramid Tripeaks Old Versions

  1. 3 Pyramid Tripeaks 1.0.30 apk (23.62 MB) 24th Mar 2015

Alternative Games to 3 Pyramid Tripeaks

  1. Solitaire Icon
    Solitaire
    MobilityWare
    Solitaire by MobilityWare is the original...
    Download APK
  2. Solitaire Icon
    Solitaire
    Brainium Studios
    Solitaire by Brainium is the #1 Solitaire...
    Download APK
  3. Solitaire™ Icon
    Solitaire™
    TaoGames Limited
    Play the #1 FREE SOLITAIRE (or Klondike...
    Download APK
  4. Pyramid Solitaire Saga Icon
    Pyramid Solitaire Saga
    King
    Release the magic Pyramid Solitaire...
    Download APK
  5. Sequence Card Game Icon
    Sequence Card Game
    ncfrank
    The classic card game is coming now! It...
    Download APK
  6. Solitaire Classic Icon
    Solitaire Classic
    Candy Mobile
    Play the most classic solitaire card game...
    Download APK
  7. Solitaire Icon
    Solitaire
    Puzzle Games Inc
    Try the best FREE SOLITAIRE card game on...
    Download APK
  8. Spider Solitaire Icon
    Spider Solitaire
    Magma Mobile
    Looking for a new card game experience ?...
    Download APK
  9. 550+ Card Games Solitaire Pack Icon
    550+ Card Games Solitaire Pack
    CommaLite
    Are you looking for an awesome Solitaire...
    Download APK

Recommended Android Games

  1. Solitaire Arena Icon
    Solitaire Arena
    MavenHut Ltd.
    6 Million people play this game on...
    Rated 4.5/5
    Download APK
  2. Mahjong Solitaire Icon
    Mahjong Solitaire
    CanadaDroid
    Mahjong Solitaire is the #1 solitaire...
    Rated 4/5
    Download APK
  3. Solitaire Classic Icon
    Solitaire Classic
    Candy Mobile
    Play the most classic solitaire card game...
    Rated 4/5
    Download APK
  4. Solitaire Icon
    Solitaire
    Softick Ltd.
    Very beautiful and quality made kerchief...
    Rated 4.5/5
    Download APK
  5. Spider Solitaire Icon
    Spider Solitaire
    1bsyl
    This card game is a Spider Solitaire...
    Rated 4/5
    Download APK
  6. 250+ Solitaire Collection Icon
    250+ Solitaire Collection
    Alexei Anoshenko
    "250+ Solitaire Collection" is a...
    Rated 4.5/5
    Download APK
  7. Spider Solitaire Icon
    Spider Solitaire
    Brainium Studios
    Spider Solitaire by Brainium is the #1...
    Rated 4.5/5
    Download APK
  8. Solitaire Free Icon
    Solitaire Free
    AI Factory Limited
    ★ Top Developer (awarded 2013 / 2015)...
    Rated 4.5/5
    Download APK
  9. Solitaire Icon
    Solitaire
    TaoGames Limited
    Play the #1 FREE SOLITAIRE (or Klondike...
    Rated 4.5/5
    Download APK
  10. Solitaire Icon
    Solitaire
    AppCoder Studio
    This is a classic solitaire game. If you...
    Rated 4/5
    Download APK

3 Pyramid Tripeaks User Reviews & Comments

appraw dino


© 2025 Appraw App Store
Terms | Privacy Policy | Contact